Lineage for d2j55j1 (2j55 J:32-386)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675262Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 675277Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families) (S)
  5. 675278Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 675279Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 675284Species Paracoccus denitrificans [TaxId:266] [50972] (10 PDB entries)
  8. 675298Domain d2j55j1: 2j55 J:32-386 [138016]
    Other proteins in same PDB: d2j55a1, d2j55b1
    automatically matched to d2bbkh_
    complexed with cu, gol, trq

Details for d2j55j1

PDB Entry: 2j55 (more details), 2.15 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase o-quinone in complex with amicyanin.
PDB Compounds: (J:) Methylamine dehydrogenase heavy chain

SCOP Domain Sequences for d2j55j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j55j1 b.69.2.1 (J:32-386) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg

SCOP Domain Coordinates for d2j55j1:

Click to download the PDB-style file with coordinates for d2j55j1.
(The format of our PDB-style files is described here.)

Timeline for d2j55j1: