![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins) mono-domain proteins |
![]() | Protein Amicyanin [49505] (2 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [49506] (20 PDB entries) Uniprot P22364 |
![]() | Domain d2j55b1: 2j55 B:1-105 [138014] Other proteins in same PDB: d2j55h1, d2j55j1, d2j55l1, d2j55m1 automatically matched to d1aac__ complexed with cu, gol, trq |
PDB Entry: 2j55 (more details), 2.15 Å
SCOP Domain Sequences for d2j55b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j55b1 b.6.1.1 (B:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d2j55b1: