Lineage for d2j50b1 (2j50 B:128-388)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734748Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 734749Species Human (Homo sapiens) [TaxId:9606] [90039] (7 PDB entries)
  8. 734756Domain d2j50b1: 2j50 B:128-388 [138012]
    automatically matched to d1ol5a_
    complexed with 627, so4

Details for d2j50b1

PDB Entry: 2j50 (more details), 3 Å

PDB Description: structure of aurora-2 in complex with pha-739358
PDB Compounds: (B:) serine/threonine-protein kinase 6

SCOP Domain Sequences for d2j50b1:

Sequence, based on SEQRES records: (download)

>d2j50b1 d.144.1.7 (B:128-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
hskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmhd
ekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhn
psqrpmlrevlehpwitanss

Sequence, based on observed residues (ATOM records): (download)

>d2j50b1 d.144.1.7 (B:128-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
hskrvihrdikpenlllgsagelkiadfgwsvtlcgtldylppemiedekvdlwslgvlc
yeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevle
hpwitanss

SCOP Domain Coordinates for d2j50b1:

Click to download the PDB-style file with coordinates for d2j50b1.
(The format of our PDB-style files is described here.)

Timeline for d2j50b1: