Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries) |
Domain d2j50b_: 2j50 B: [138012] automated match to d3dfcb_ complexed with 627, so4 |
PDB Entry: 2j50 (more details), 3 Å
SCOPe Domain Sequences for d2j50b_:
Sequence, based on SEQRES records: (download)
>d2j50b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc hskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrmhd ekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhn psqrpmlrevlehpwitanssk
>d2j50b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc hskrvihrdikpenlllgsagelkiadfgwsvtlcgtldylppemiedekvdlwslgvlc yeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevle hpwitanssk
Timeline for d2j50b_: