Lineage for d2j4zb_ (2j4z B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2222237Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)
  8. 2222436Domain d2j4zb_: 2j4z B: [138010]
    automated match to d1jksa_
    complexed with 626, ars

Details for d2j4zb_

PDB Entry: 2j4z (more details), 2 Å

PDB Description: structure of aurora-2 in complex with pha-680626
PDB Compounds: (B:) serine threonine-protein kinase 6

SCOPe Domain Sequences for d2j4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4zb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitansskpsncqn

SCOPe Domain Coordinates for d2j4zb_:

Click to download the PDB-style file with coordinates for d2j4zb_.
(The format of our PDB-style files is described here.)

Timeline for d2j4zb_: