Lineage for d2j4wl1 (2j4w L:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766901Domain d2j4wl1: 2j4w L:1-107 [138007]
    Other proteins in same PDB: d2j4wd1, d2j4wh1, d2j4wh2, d2j4wl2
    automated match to d2g2ra1

Details for d2j4wl1

PDB Entry: 2j4w (more details), 2.5 Å

PDB Description: structure of a plasmodium vivax apical membrane antigen 1-fab f8.12.19 complex
PDB Compounds: (L:) fab fragment of monoclonal antibody f8.12.19

SCOPe Domain Sequences for d2j4wl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4wl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esvlsqspailsaspgekvtmtcrarssvsymhwyqqksgsspkpwihatsnlasgvpar
fsgsgsgtsysltisrveaedaatyycqqwsshpptfgsgtkleik

SCOPe Domain Coordinates for d2j4wl1:

Click to download the PDB-style file with coordinates for d2j4wl1.
(The format of our PDB-style files is described here.)

Timeline for d2j4wl1: