SCOPe 2.04: Domain d2j4wl1: 2j4w L:1-107

Lineage for d2j4wl1 (2j4w L:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d2j4wl1: 2j4w L:1-107 [138007]
   Other proteins in same PDB: d2j4wd1, d2j4wh1, d2j4wh2, d2j4wl2
   automated match to d2g2ra1

Details for d2j4wl1

PDB Entry: 2j4w, 2.5 Å

PDB Description: structure of a plasmodium vivax apical membrane antigen 1-fab f8.12.19 complex

PDB Compounds: (L:) fab fragment of monoclonal antibody f8.12.19

SCOPe Domain Sequences for d2j4wl1:

Sequence; same for both SEQRES and ATOM records:

>d2j4wl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esvlsqspailsaspgekvtmtcrarssvsymhwyqqksgsspkpwihatsnlasgvpar
fsgsgsgtsysltisrveaedaatyycqqwsshpptfgsgtkleik

Timeline for d2j4wl1:

• d2j4wl1 first appeared in SCOP 1.73
  
• d2j4wl1 appears in SCOPe 2.03
  
• d2j4wl1 appears in SCOPe 2.05
  
• d2j4wl1 appears in the current release, SCOPe 2.08