![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
![]() | Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries) Uniprot Q89ZI2 25-147 |
![]() | Domain d2j47a3: 2j47 A:4-126 [137993] Other proteins in same PDB: d2j47a1, d2j47a2 complexed with gdv, gol |
PDB Entry: 2j47 (more details), 1.98 Å
SCOPe Domain Sequences for d2j47a3:
Sequence, based on SEQRES records: (download)
>d2j47a3 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd yps
>d2j47a3 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} slqpppqqlivqnktidyqlnggeeanphavkvlkellsggmlisigekgdksvrkysrq ipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps
Timeline for d2j47a3: