Lineage for d2j47a2 (2j47 A:127-436)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683515Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 protein domains)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 683536Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)
  7. 683537Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (3 PDB entries)
  8. 683542Domain d2j47a2: 2j47 A:127-436 [137992]
    Other proteins in same PDB: d2j47a1, d2j47a3
    complexed with gdv, gol

Details for d2j47a2

PDB Entry: 2j47 (more details), 1.98 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with a imidazole-pugnac hybrid inhibitor
PDB Compounds: (A:) glucosaminidase

SCOP Domain Sequences for d2j47a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j47a2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

SCOP Domain Coordinates for d2j47a2:

Click to download the PDB-style file with coordinates for d2j47a2.
(The format of our PDB-style files is described here.)

Timeline for d2j47a2: