SCOP 1.73: Domain d2j47a2: 2j47 A:127-436

Lineage for d2j47a2 (2j47 A:127-436)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins)
   Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain

6. Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (3 PDB entries)

8. Domain d2j47a2: 2j47 A:127-436 [137992]
   Other proteins in same PDB: d2j47a1, d2j47a3
   complexed with gdv, gol

Details for d2j47a2

PDB Entry: 2j47, 1.98 Å

PDB Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with a imidazole-pugnac hybrid inhibitor

PDB Compounds: (A:) glucosaminidase

SCOP Domain Sequences for d2j47a2:

Sequence; same for both SEQRES and ATOM records:

>d2j47a2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

Timeline for d2j47a2:

• d2j47a2 is new in SCOP 1.73
  
• d2j47a2 appears in SCOP 1.75
  
• d2j47a2 appears in the current release, SCOPe 2.08