Lineage for d2j46b2 (2j46 B:89-297)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696576Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 696707Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 696718Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries)
  8. 696723Domain d2j46b2: 2j46 B:89-297 [137990]
    Other proteins in same PDB: d2j46a1, d2j46b1
    automatically matched to d2ffha3
    complexed with act, cl, mn, mrd

Details for d2j46b2

PDB Entry: 2j46 (more details), 1.14 Å

PDB Description: water structure of t. aquaticus ffh ng domain at 1.1a resolution
PDB Compounds: (B:) signal recognition particle protein

SCOP Domain Sequences for d2j46b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j46b2 c.37.1.10 (B:89-297) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdv

SCOP Domain Coordinates for d2j46b2:

Click to download the PDB-style file with coordinates for d2j46b2.
(The format of our PDB-style files is described here.)

Timeline for d2j46b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j46b1