Lineage for d2j46b1 (2j46 B:1-88)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313661Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 2313662Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 2313677Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 2313689Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries)
  8. 2313694Domain d2j46b1: 2j46 B:1-88 [137989]
    Other proteins in same PDB: d2j46a2, d2j46b2
    automated match to d1o87a1
    complexed with act, cl, mn, mrd

Details for d2j46b1

PDB Entry: 2j46 (more details), 1.14 Å

PDB Description: water structure of t. aquaticus ffh ng domain at 1.1a resolution
PDB Compounds: (B:) signal recognition particle protein

SCOPe Domain Sequences for d2j46b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j46b1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOPe Domain Coordinates for d2j46b1:

Click to download the PDB-style file with coordinates for d2j46b1.
(The format of our PDB-style files is described here.)

Timeline for d2j46b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j46b2