![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries) |
![]() | Domain d2j46a2: 2j46 A:89-296 [137988] Other proteins in same PDB: d2j46a1, d2j46b1 automatically matched to d2ffha3 complexed with act, cl, mn, mrd |
PDB Entry: 2j46 (more details), 1.14 Å
SCOP Domain Sequences for d2j46a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j46a2 c.37.1.10 (A:89-296) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy fagvsekpeglepfyperlagrilgmgd
Timeline for d2j46a2: