SCOPe 2.06: Domain d2j45b2: 2j45 B:89-297

Lineage for d2j45b2 (2j45 B:89-297)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (17 PDB entries)

8. Domain d2j45b2: 2j45 B:89-297 [137986]
   Other proteins in same PDB: d2j45a1, d2j45b1
   automated match to d1o87a2
   complexed with ca, edo, mes, mrd, na

Details for d2j45b2

PDB Entry: 2j45, 1.14 Å

PDB Description: water structure of t. aquaticus ffh ng domain at 1.1a resolution

PDB Compounds: (B:) signal recognition particle protein

SCOPe Domain Sequences for d2j45b2:

Sequence; same for both SEQRES and ATOM records:

>d2j45b2 c.37.1.10 (B:89-297) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdv

Timeline for d2j45b2:

• d2j45b2 first appeared in SCOP 1.73
  
• d2j45b2 appears in SCOPe 2.05
  
• d2j45b2 appears in SCOPe 2.07
  
• d2j45b2 appears in the current release, SCOPe 2.08