Lineage for d2j45b1 (2j45 B:1-88)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638207Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 638208Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 638227Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 638238Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries)
  8. 638241Domain d2j45b1: 2j45 B:1-88 [137985]
    Other proteins in same PDB: d2j45a2, d2j45b2
    automatically matched to d2ffha1
    complexed with ca, edo, mes, mrd, na

Details for d2j45b1

PDB Entry: 2j45 (more details), 1.14 Å

PDB Description: water structure of t. aquaticus ffh ng domain at 1.1a resolution
PDB Compounds: (B:) signal recognition particle protein

SCOP Domain Sequences for d2j45b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j45b1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d2j45b1:

Click to download the PDB-style file with coordinates for d2j45b1.
(The format of our PDB-style files is described here.)

Timeline for d2j45b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j45b2