| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species) |
| Species Thermus aquaticus [TaxId:271] [52665] (16 PDB entries) |
| Domain d2j45a2: 2j45 A:89-297 [137984] Other proteins in same PDB: d2j45a1, d2j45b1 automated match to d1o87a2 complexed with ca, edo, mes, mrd, na |
PDB Entry: 2j45 (more details), 1.14 Å
SCOPe Domain Sequences for d2j45a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j45a2 c.37.1.10 (A:89-297) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgdv
Timeline for d2j45a2: