SCOPe 2.07: Domain d2j45a1: 2j45 A:1-88

Lineage for d2j45a1 (2j45 A:1-88)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries)

8. Domain d2j45a1: 2j45 A:1-88 [137983]
   Other proteins in same PDB: d2j45a2, d2j45b2
   automated match to d1o87a1
   complexed with ca, edo, mes, mrd, na

Details for d2j45a1

PDB Entry: 2j45, 1.14 Å

PDB Description: water structure of t. aquaticus ffh ng domain at 1.1a resolution

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d2j45a1:

Sequence; same for both SEQRES and ATOM records:

>d2j45a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d2j45a1:

• d2j45a1 first appeared in SCOP 1.73
  
• d2j45a1 appears in SCOPe 2.06
  
• d2j45a1 appears in the current release, SCOPe 2.08