![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) ![]() |
![]() | Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
![]() | Protein Signal sequence recognition protein Ffh [47366] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries) |
![]() | Domain d2j45a1: 2j45 A:1-88 [137983] Other proteins in same PDB: d2j45a2, d2j45b2 automatically matched to d2ffha1 complexed with ca, edo, mes, mrd, na |
PDB Entry: 2j45 (more details), 1.14 Å
SCOP Domain Sequences for d2j45a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j45a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal gkqvlesltpaevilatvyealkealgg
Timeline for d2j45a1: