SCOPe 2.08: Domain d2j3wc_: 2j3w C:

Lineage for d2j3wc_ (2j3w C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (5 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.3: Sedlin (SEDL) [82767] (1 protein)
   automatically mapped to Pfam PF04628

6. Protein Sedlin (SEDL) [82768] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82769] (2 PDB entries)

8. Domain d2j3wc_: 2j3w C: [137982]
   Other proteins in same PDB: d2j3wb1, d2j3wd_, d2j3we_, d2j3wf_
   automated match to d1h3qa_
   complexed with plm

Details for d2j3wc_

PDB Entry: 2j3w, 2.1 Å

PDB Description: The crystal structure of the bet3-trs31-sedlin complex.

PDB Compounds: (C:) trafficking protein particle complex protein 2

SCOPe Domain Sequences for d2j3wc_:

Sequence, based on SEQRES records:

>d2j3wc_ d.110.4.3 (C:) Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090]}
lemsgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnn
mylktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepn
spirssafdrkvqflgkkhlls

Sequence, based on observed residues (ATOM records):

>d2j3wc_ d.110.4.3 (C:) Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090]}
lemsgsfyfvivghhdnpvfemeflppgkrhlnqfiahaaldlvdenmwlsnnmylktvd
kfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnspirssa
fdrkvqflgkkhlls

Timeline for d2j3wc_:

• d2j3wc_ first appeared in SCOP 1.73, called d2j3wc1
  
• d2j3wc_ appears in SCOPe 2.07