Lineage for d2j3wc_ (2j3w C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2535171Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 2535199Family d.110.4.3: Sedlin (SEDL) [82767] (1 protein)
    automatically mapped to Pfam PF04628
  6. 2535200Protein Sedlin (SEDL) [82768] (1 species)
  7. 2535201Species Mouse (Mus musculus) [TaxId:10090] [82769] (2 PDB entries)
  8. 2535203Domain d2j3wc_: 2j3w C: [137982]
    Other proteins in same PDB: d2j3wb1, d2j3wd_, d2j3we_, d2j3wf_
    automated match to d1h3qa_
    complexed with plm

Details for d2j3wc_

PDB Entry: 2j3w (more details), 2.1 Å

PDB Description: The crystal structure of the bet3-trs31-sedlin complex.
PDB Compounds: (C:) trafficking protein particle complex protein 2

SCOPe Domain Sequences for d2j3wc_:

Sequence, based on SEQRES records: (download)

>d2j3wc_ d.110.4.3 (C:) Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090]}
lemsgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnn
mylktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepn
spirssafdrkvqflgkkhlls

Sequence, based on observed residues (ATOM records): (download)

>d2j3wc_ d.110.4.3 (C:) Sedlin (SEDL) {Mouse (Mus musculus) [TaxId: 10090]}
lemsgsfyfvivghhdnpvfemeflppgkrhlnqfiahaaldlvdenmwlsnnmylktvd
kfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnspirssa
fdrkvqflgkkhlls

SCOPe Domain Coordinates for d2j3wc_:

Click to download the PDB-style file with coordinates for d2j3wc_.
(The format of our PDB-style files is described here.)

Timeline for d2j3wc_: