![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.201: SRP19 [69694] (1 superfamily) beta-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.201.1: SRP19 [69695] (2 families) ![]() automatically mapped to Pfam PF01922 |
![]() | Family d.201.1.1: SRP19 [69696] (1 protein) |
![]() | Protein SRP19 [69697] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69698] (4 PDB entries) |
![]() | Domain d2j37b1: 2j37 B:14-118 [137978] automatically matched to d1jida_ |
PDB Entry: 2j37 (more details), 8 Å
SCOPe Domain Sequences for d2j37b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j37b1 d.201.1.1 (B:14-118) SRP19 {Human (Homo sapiens) [TaxId: 9606]} rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr
Timeline for d2j37b1: