Lineage for d2j37b1 (2j37 B:14-118)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228852Fold d.201: SRP19 [69694] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1228853Superfamily d.201.1: SRP19 [69695] (1 family) (S)
  5. 1228854Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 1228855Protein SRP19 [69697] (3 species)
  7. 1228859Species Human (Homo sapiens) [TaxId:9606] [69698] (4 PDB entries)
  8. 1228863Domain d2j37b1: 2j37 B:14-118 [137978]
    automatically matched to d1jida_

Details for d2j37b1

PDB Entry: 2j37 (more details), 8 Å

PDB Description: model of mammalian srp bound to 80s rncs
PDB Compounds: (B:) Signal recognition particle 19 kDa protein (SRP19)

SCOPe Domain Sequences for d2j37b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j37b1 d.201.1.1 (B:14-118) SRP19 {Human (Homo sapiens) [TaxId: 9606]}
rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn
rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktr

SCOPe Domain Coordinates for d2j37b1:

Click to download the PDB-style file with coordinates for d2j37b1.
(The format of our PDB-style files is described here.)

Timeline for d2j37b1: