Lineage for d2j2za2 (2j2z A:125-217)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1115534Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1115687Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) (S)
  5. 1115688Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 1115729Protein PapD [49586] (1 species)
  7. 1115730Species Escherichia coli [TaxId:562] [49587] (9 PDB entries)
  8. 1115731Domain d2j2za2: 2j2z A:125-217 [137975]
    Other proteins in same PDB: d2j2za1, d2j2zb1
    automatically matched to d3dpa_2
    complexed with co, so4

Details for d2j2za2

PDB Entry: 2j2z (more details), 2.3 Å

PDB Description: x-ray structure of the chaperone papd in complex with the pilus terminator subunit paph at 2.3 angstrom resolution
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d2j2za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j2za2 b.7.2.1 (A:125-217) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkke

SCOPe Domain Coordinates for d2j2za2:

Click to download the PDB-style file with coordinates for d2j2za2.
(The format of our PDB-style files is described here.)

Timeline for d2j2za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j2za1
View in 3D
Domains from other chains:
(mouse over for more information)
d2j2zb1