Lineage for d2j2za1 (2j2z A:1-124)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111327Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 1111328Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 1111377Protein Pilus chaperone PapD, N-domain [49356] (1 species)
    consists of two domains of this fold; domain 2 has an additional strand at the C-terminus
  7. 1111378Species Escherichia coli [TaxId:562] [49357] (9 PDB entries)
  8. 1111379Domain d2j2za1: 2j2z A:1-124 [137974]
    Other proteins in same PDB: d2j2za2, d2j2zb1
    automatically matched to d3dpa_1
    complexed with co, so4

Details for d2j2za1

PDB Entry: 2j2z (more details), 2.3 Å

PDB Description: x-ray structure of the chaperone papd in complex with the pilus terminator subunit paph at 2.3 angstrom resolution
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d2j2za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j2za1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

SCOPe Domain Coordinates for d2j2za1:

Click to download the PDB-style file with coordinates for d2j2za1.
(The format of our PDB-style files is described here.)

Timeline for d2j2za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j2za2
View in 3D
Domains from other chains:
(mouse over for more information)
d2j2zb1