SCOP 1.73: Domain d2j2za1: 2j2z A:1-124

Lineage for d2j2za1 (2j2z A:1-124)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (4 proteins)

6. Protein Pilus chaperone PapD, N-domain [49356] (1 species)
   consists of two domains of this fold; domain 2 has an additional strand at the C-terminus

7. Species Escherichia coli [TaxId:562] [49357] (9 PDB entries)

8. Domain d2j2za1: 2j2z A:1-124 [137974]
   Other proteins in same PDB: d2j2za2
   automatically matched to d3dpa_1
   complexed with co, so4

Details for d2j2za1

PDB Entry: 2j2z, 2.3 Å

PDB Description: x-ray structure of the chaperone papd in complex with the pilus terminator subunit paph at 2.3 angstrom resolution

PDB Compounds: (A:) chaperone protein papd

SCOP Domain Sequences for d2j2za1:

Sequence; same for both SEQRES and ATOM records:

>d2j2za1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

Timeline for d2j2za1:

• d2j2za1 is new in SCOP 1.73
  
• d2j2za1 appears in SCOP 1.75
  
• d2j2za1 appears in the current release, SCOPe 2.08