Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein) Pfam PF01245 |
Protein Ribosomal protein L19 [141246] (3 species) |
Species Escherichia coli [TaxId:562] [141247] (9 PDB entries) Uniprot P0A7K6 1-114 |
Domain d2j28p1: 2j28 P:1-114 [137966] Other proteins in same PDB: d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1 automatically matched to 2AW4 P:1-114 protein/RNA complex; complexed with mg |
PDB Entry: 2j28 (more details), 8 Å
SCOPe Domain Sequences for d2j28p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j28p1 b.34.5.6 (P:1-114) Ribosomal protein L19 {Escherichia coli [TaxId: 562]} sniikqleqeqmkqdvpsfrpgdtvevkvwvvegskkrlqafegvviairnrglhsaftv rkisngegvervfqthspvvdsisvkrrgavrkaklyylrertgkaarikerln
Timeline for d2j28p1:
View in 3D Domains from other chains: (mouse over for more information) d2j2801, d2j2811, d2j2821, d2j2831, d2j2841, d2j28c1, d2j28c2, d2j28d1, d2j28e1, d2j28f1, d2j28g1, d2j28g2, d2j28h1, d2j28h2, d2j28i1, d2j28i2, d2j28j1, d2j28k1, d2j28l1, d2j28m1, d2j28n1, d2j28o1, d2j28q1, d2j28r1, d2j28s1, d2j28t1, d2j28u1, d2j28v1, d2j28w1, d2j28x1, d2j28y1, d2j28z1 |