![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Glucosylceramidase, catalytic domain [89473] (1 species) acid-beta-glucosidase; glycosyl hydrolase family 30; contains additional beta-domain similar to one found in alpha amylases |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89474] (23 PDB entries) |
![]() | Domain d2j25b2: 2j25 B:78-431 [137958] Other proteins in same PDB: d2j25a1, d2j25b1 automated match to d1ogsa2 complexed with nag, so4 |
PDB Entry: 2j25 (more details), 2.9 Å
SCOPe Domain Sequences for d2j25b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j25b2 c.1.8.3 (B:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} vkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyad tpddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgsl kgqpgdiyhqtwaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqr dfiardlgptlansthhnvrllmlddqrlllphwakvvltdpeaakyvhgiavhwyldfl apakatlgethrlfpntmlfaseacvgskfweqsvrlgswdrgmqyshsiitnllyhvvg wtdwnlalnpeggpnwvrnfvdspiivditkdtfykqpmfyhlghfskfipegs
Timeline for d2j25b2: