![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
![]() | Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48731] (8 PDB entries) |
![]() | Domain d2j1kv1: 2j1k V:21-137 [137949] Other proteins in same PDB: d2j1kc1, d2j1kd1, d2j1ke1, d2j1kf1, d2j1kh1, d2j1ki1, d2j1kl1, d2j1km1, d2j1kn1, d2j1kq1, d2j1kr1, d2j1ks1 automatically matched to d1rsfa_ |
PDB Entry: 2j1k (more details), 2.3 Å
SCOP Domain Sequences for d2j1kv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1kv1 b.1.1.1 (V:21-137) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv
Timeline for d2j1kv1: