SCOPe 2.01: Domain d2j1kt_: 2j1k T:

Lineage for d2j1kt_ (2j1k T:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (24 PDB entries)

8. Domain d2j1kt_: 2j1k T: [137948]
   Other proteins in same PDB: d2j1kc1, d2j1kd_, d2j1ke_, d2j1kf_, d2j1kh_, d2j1ki_, d2j1kl_, d2j1km_, d2j1kn_, d2j1kq_, d2j1kr_, d2j1ks_
   automated match to d1eaja_

Details for d2j1kt_

PDB Entry: 2j1k, 2.3 Å

PDB Description: cav-2 fibre head in complex with car d1

PDB Compounds: (T:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d2j1kt_:

Sequence; same for both SEQRES and ATOM records:

>d2j1kt_ b.1.1.1 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv

Timeline for d2j1kt_:

• d2j1kt_ first appeared in SCOP 1.73, called d2j1kt1
  
• d2j1kt_ was called d2j1kt1 in SCOP 1.75
  
• d2j1kt_ appears in SCOPe 2.02
  
• d2j1kt_ appears in the current release, SCOPe 2.08