Lineage for d2j1kt1 (2j1k T:21-137)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781710Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 781711Species Human (Homo sapiens) [TaxId:9606] [48731] (8 PDB entries)
  8. 781724Domain d2j1kt1: 2j1k T:21-137 [137948]
    Other proteins in same PDB: d2j1kc1, d2j1kd1, d2j1ke1, d2j1kf1, d2j1kh1, d2j1ki1, d2j1kl1, d2j1km1, d2j1kn1, d2j1kq1, d2j1kr1, d2j1ks1
    automatically matched to d1rsfa_

Details for d2j1kt1

PDB Entry: 2j1k (more details), 2.3 Å

PDB Description: cav-2 fibre head in complex with car d1
PDB Compounds: (T:) coxsackievirus and adenovirus receptor

SCOP Domain Sequences for d2j1kt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1kt1 b.1.1.1 (T:21-137) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv

SCOP Domain Coordinates for d2j1kt1:

Click to download the PDB-style file with coordinates for d2j1kt1.
(The format of our PDB-style files is described here.)

Timeline for d2j1kt1: