Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48731] (8 PDB entries) |
Domain d2j1kt1: 2j1k T:21-137 [137948] automatically matched to d1rsfa_ |
PDB Entry: 2j1k (more details), 2.3 Å
SCOP Domain Sequences for d2j1kt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1kt1 b.1.1.1 (T:21-137) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv
Timeline for d2j1kt1: