SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2j1kk_ (2j1k K:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (20 species)
    not a true protein
  7. 2019694Species Human (Homo sapiens) [TaxId:9606] [188740] (154 PDB entries)
  8. 2019775Domain d2j1kk_: 2j1k K: [137945]
    Other proteins in same PDB: d2j1kc1, d2j1kd_, d2j1ke_, d2j1kf_, d2j1kh_, d2j1ki_, d2j1kl_, d2j1km_, d2j1kn_, d2j1kq_, d2j1kr_, d2j1ks_
    automated match to d1eaja_

Details for d2j1kk_

PDB Entry: 2j1k (more details), 2.3 Å

PDB Description: cav-2 fibre head in complex with car d1
PDB Compounds: (K:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d2j1kk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1kk_ b.1.1.1 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
vvl

SCOPe Domain Coordinates for d2j1kk_:

Click to download the PDB-style file with coordinates for d2j1kk_.
(The format of our PDB-style files is described here.)

Timeline for d2j1kk_: