Lineage for d2j1kj_ (2j1k J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742420Domain d2j1kj_: 2j1k J: [137944]
    Other proteins in same PDB: d2j1kc1, d2j1kd_, d2j1ke_, d2j1kf_, d2j1kh_, d2j1ki_, d2j1kl_, d2j1km_, d2j1kn_, d2j1kq_, d2j1kr_, d2j1ks_
    automated match to d1eaja_

Details for d2j1kj_

PDB Entry: 2j1k (more details), 2.3 Å

PDB Description: cav-2 fibre head in complex with car d1
PDB Compounds: (J:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d2j1kj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j1kj_ b.1.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
vlv

SCOPe Domain Coordinates for d2j1kj_:

Click to download the PDB-style file with coordinates for d2j1kj_.
(The format of our PDB-style files is described here.)

Timeline for d2j1kj_: