![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
![]() | Domain d2j1kg_: 2j1k G: [137943] Other proteins in same PDB: d2j1kc1, d2j1kd_, d2j1ke_, d2j1kf_, d2j1kh_, d2j1ki_, d2j1kl_, d2j1km_, d2j1kn_, d2j1kq_, d2j1kr_, d2j1ks_ automated match to d1eaja_ |
PDB Entry: 2j1k (more details), 2.3 Å
SCOPe Domain Sequences for d2j1kg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j1kg_ b.1.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv vlv
Timeline for d2j1kg_: