Lineage for d2j19a1 (2j19 A:0-119)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 641439Superfamily a.39.3: Cloroperoxidase [47571] (1 family) (S)
    duplication: consists of 2 similar domains composed of 2 EF hand-like motifs each
  5. 641440Family a.39.3.1: Cloroperoxidase [47572] (1 protein)
  6. 641441Protein Cloroperoxidase [47573] (1 species)
  7. 641442Species Fungus (Caldariomyces fumago) [TaxId:5474] [47574] (13 PDB entries)
  8. 641459Domain d2j19a1: 2j19 A:0-119 [137939]
    automatically matched to d1cpo_1
    complexed with br, hem, man, mn, nag

Details for d2j19a1

PDB Entry: 2j19 (more details), 1.75 Å

PDB Description: ferrous chloroperoxidase (high dose data set)
PDB Compounds: (A:) chloroperoxidase

SCOP Domain Sequences for d2j19a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j19a1 a.39.3.1 (A:0-119) Cloroperoxidase {Fungus (Caldariomyces fumago) [TaxId: 5474]}
eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva

SCOP Domain Coordinates for d2j19a1:

Click to download the PDB-style file with coordinates for d2j19a1.
(The format of our PDB-style files is described here.)

Timeline for d2j19a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j19a2