Lineage for d2j14b1 (2j14 B:175-439)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 648142Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 648143Species Human (Homo sapiens) [TaxId:9606] [48527] (8 PDB entries)
  8. 648157Domain d2j14b1: 2j14 B:175-439 [137936]
    automatically matched to d1gwxa_
    complexed with gni

Details for d2j14b1

PDB Entry: 2j14 (more details), 2.8 Å

PDB Description: 3,4,5-trisubstituted isoxazoles as novel ppardelta agonists: part2
PDB Compounds: (B:) Peroxisome proliferator-activated receptor delta

SCOP Domain Sequences for d2j14b1:

Sequence, based on SEQRES records: (download)

>d2j14b1 a.123.1.1 (B:175-439) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvteha
qmmqrikktetetslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d2j14b1 a.123.1.1 (B:175-439) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkpfvihdietlwqaekgllppykeisvhvfy
rcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvan
gsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnv
prveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikktetet
slhpllqeiykd

SCOP Domain Coordinates for d2j14b1:

Click to download the PDB-style file with coordinates for d2j14b1.
(The format of our PDB-style files is described here.)

Timeline for d2j14b1: