Lineage for d2j13a1 (2j13 A:1-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850644Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
  6. 2850659Protein Putative polysaccharide deacetylase BA0424 [141957] (1 species)
  7. 2850660Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [141958] (1 PDB entry)
    Uniprot Q81Z49 54-258
  8. 2850661Domain d2j13a1: 2j13 A:1-235 [137934]
    complexed with act, cac, zn

Details for d2j13a1

PDB Entry: 2j13 (more details), 1.7 Å

PDB Description: structure of a family 4 carbohydrate esterase from bacillus anthracis
PDB Compounds: (A:) polysaccharide deacetylase

SCOPe Domain Sequences for d2j13a1:

Sequence, based on SEQRES records: (download)

>d2j13a1 c.6.2.3 (A:1-235) Putative polysaccharide deacetylase BA0424 {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
maytntphnwgiprpknetvpdagklytdllqknggfylgdtkkkdiyltfdngyengyt
gkildvlkekkvpatffvtghyiktqkdlllrmkdeghiignhswshpdftavndeklre
eltsvteeikkvtgqkevkyvrpprgvfsertlaltkemgyynvfwslafldwkvdeqrg
wqyahnnvmtmihpgsilllhaiskdnaealakiiddlrekgyhfkslddlvksn

Sequence, based on observed residues (ATOM records): (download)

>d2j13a1 c.6.2.3 (A:1-235) Putative polysaccharide deacetylase BA0424 {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
maytntphnwgiagklytdllqknggfylgdtkkkdiyltfdngyengytgkildvlkek
kvpatffvtghyiktqkdlllrmkdeghiignhswshpdftavndeklreeltsvteeik
kvtgqkevkyvrpprgvfsertlaltkemgyynvfwslafldwihpgsilllhaiskdna
ealakiiddlrekgyhfkslddlvksn

SCOPe Domain Coordinates for d2j13a1:

Click to download the PDB-style file with coordinates for d2j13a1.
(The format of our PDB-style files is described here.)

Timeline for d2j13a1: