Class b: All beta proteins [48724] (177 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein automated matches [190333] (4 species) not a true protein |
Species Human adenovirus 37 [TaxId:52275] [188823] (4 PDB entries) |
Domain d2j12a_: 2j12 A: [137932] Other proteins in same PDB: d2j12b_ automated match to d1uxaa_ complexed with ca |
PDB Entry: 2j12 (more details), 1.5 Å
SCOPe Domain Sequences for d2j12a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j12a_ b.21.1.1 (A:) automated matches {Human adenovirus 37 [TaxId: 52275]} rtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkiks ftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskkya rdivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyia qe
Timeline for d2j12a_: