SCOPe 2.05: Domain d2j12a_: 2j12 A:

Lineage for d2j12a_ (2j12 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein automated matches [190333] (4 species)
   not a true protein

7. Species Human adenovirus 37 [TaxId:52275] [188823] (4 PDB entries)

8. Domain d2j12a_: 2j12 A: [137932]
   Other proteins in same PDB: d2j12b_
   automated match to d1uxaa_
   complexed with ca

Details for d2j12a_

PDB Entry: 2j12, 1.5 Å

PDB Description: ad37 fibre head in complex with car d1

PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d2j12a_:

Sequence; same for both SEQRES and ATOM records:

>d2j12a_ b.21.1.1 (A:) automated matches {Human adenovirus 37 [TaxId: 52275]}
rtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkiks
ftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskkya
rdivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyia
qe

Timeline for d2j12a_:

• d2j12a_ first appeared in SCOP 1.73, called d2j12a1
  
• d2j12a_ appears in SCOPe 2.04
  
• d2j12a_ appears in SCOPe 2.06
  
• d2j12a_ appears in the current release, SCOPe 2.08