| Class b: All beta proteins [48724] (165 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families) ![]() |
| Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein) |
| Protein Adenovirus fiber protein "knob" domain [49837] (5 species) |
| Species Human adenovirus type 37 [TaxId:52275] [110136] (4 PDB entries) |
| Domain d2j12a1: 2j12 A:184-365 [137932] Other proteins in same PDB: d2j12b1 automatically matched to d1uxaa_ complexed with ca |
PDB Entry: 2j12 (more details), 1.5 Å
SCOP Domain Sequences for d2j12a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j12a1 b.21.1.1 (A:184-365) Adenovirus fiber protein "knob" domain {Human adenovirus type 37 [TaxId: 38437]}
rtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkiks
ftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskkya
rdivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyia
qe
Timeline for d2j12a1: