Lineage for d2j12a1 (2j12 A:184-365)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662665Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 662666Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families) (S)
  5. 662667Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein)
  6. 662668Protein Adenovirus fiber protein "knob" domain [49837] (5 species)
  7. 662691Species Human adenovirus type 37 [TaxId:52275] [110136] (4 PDB entries)
  8. 662692Domain d2j12a1: 2j12 A:184-365 [137932]
    Other proteins in same PDB: d2j12b1
    automatically matched to d1uxaa_
    complexed with ca

Details for d2j12a1

PDB Entry: 2j12 (more details), 1.5 Å

PDB Description: ad37 fibre head in complex with car d1
PDB Compounds: (A:) fiber protein

SCOP Domain Sequences for d2j12a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j12a1 b.21.1.1 (A:184-365) Adenovirus fiber protein "knob" domain {Human adenovirus type 37 [TaxId: 38437]}
rtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkiks
ftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskkya
rdivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyia
qe

SCOP Domain Coordinates for d2j12a1:

Click to download the PDB-style file with coordinates for d2j12a1.
(The format of our PDB-style files is described here.)

Timeline for d2j12a1: