SCOP 1.73: Domain d2j0wa2: 2j0w A:295-385

Lineage for d2j0wa2 (2j0w A:295-385)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (12 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
   duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family

6. Protein Aspartokinase [143391] (3 species)

7. Species Escherichia coli [TaxId:562] [143393] (2 PDB entries)
   Lysine-sensitive aspartokinase 3

8. Domain d2j0wa2: 2j0w A:295-385 [137924]
   Other proteins in same PDB: d2j0wa1
   complexed with adp, asp, cl, mg

Details for d2j0wa2

PDB Entry: 2j0w, 2.5 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with aspartate and adp (r-state)

PDB Compounds: (A:) lysine-sensitive aspartokinase 3

SCOP Domain Sequences for d2j0wa2:

Sequence; same for both SEQRES and ATOM records:

>d2j0wa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]}
npplfralalrrnqtlltlhslnmlhsrgflaevfgilarhnisvdlittsevsvaltld
ttgststgdtlltqsllmelsalcrveveeg

Timeline for d2j0wa2:

• d2j0wa2 is new in SCOP 1.73
  
• d2j0wa2 appears in SCOP 1.75
  
• d2j0wa2 appears in the current release, SCOPe 2.08