Lineage for d2j0wa1 (2j0w A:3-294)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708177Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 708178Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 708221Family c.73.1.3: PyrH-like [142721] (3 proteins)
    part of Pfam PF00696
  6. 708222Protein Aspartokinase [142724] (3 species)
  7. 708223Species Escherichia coli [TaxId:562] [142727] (2 PDB entries)
    Lysine-sensitive aspartokinase 3
  8. 708224Domain d2j0wa1: 2j0w A:3-294 [137923]
    Other proteins in same PDB: d2j0wa2, d2j0wa3
    complexed with adp, asp, cl, mg

Details for d2j0wa1

PDB Entry: 2j0w (more details), 2.5 Å

PDB Description: crystal structure of e. coli aspartokinase iii in complex with aspartate and adp (r-state)
PDB Compounds: (A:) lysine-sensitive aspartokinase 3

SCOP Domain Sequences for d2j0wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0wa1 c.73.1.3 (A:3-294) Aspartokinase {Escherichia coli [TaxId: 562]}
eivvskfggtsvadfdamnrsadivlsdanvrlvvlsasagitnllvalaeglepgerfe
kldairniqfailerlrypnvireeierllenitvlaeaaalatspaltdelvshgelms
tllfveilrerdvqaqwfdvrkvmrtndrfgraepdiaalaelaalqllprlneglvitq
gfigsenkgrtttlgrggsdytaallaealhasrvdiwtdvpgiyttdprvvsaakride
iafaeaaematfgakvlhpatllpavrsdipvfvgsskdpraggtlvcnkte

SCOP Domain Coordinates for d2j0wa1:

Click to download the PDB-style file with coordinates for d2j0wa1.
(The format of our PDB-style files is described here.)

Timeline for d2j0wa1: