SCOP 1.73: Domain d2j0tf1: 2j0t F:1-124

Lineage for d2j0tf1 (2j0t F:1-124)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (3 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
   contains an irregular alpha+beta subdomain in the C-terminal extension

6. Protein TIMP-1 [50244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50245] (4 PDB entries)

8. Domain d2j0tf1: 2j0t F:1-124 [137922]
   Other proteins in same PDB: d2j0ta1, d2j0tb1, d2j0tc1
   automatically matched to d1d2ba_
   complexed with ca, zn

Details for d2j0tf1

PDB Entry: 2j0t, 2.54 Å

PDB Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1

PDB Compounds: (F:) Metalloproteinase inhibitor 1

SCOP Domain Sequences for d2j0tf1:

Sequence; same for both SEQRES and ATOM records:

>d2j0tf1 b.40.3.1 (F:1-124) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
tvgc

Timeline for d2j0tf1:

• d2j0tf1 is new in SCOP 1.73
  
• d2j0tf1 appears in SCOP 1.75
  
• d2j0tf1 appears in the current release, SCOPe 2.08, called d2j0tf_