Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.3: TIMP-like [50242] (4 families) |
Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins) contains an irregular alpha+beta subdomain in the C-terminal extension automatically mapped to Pfam PF00965 |
Protein TIMP-1 [50244] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50245] (6 PDB entries) |
Domain d2j0td_: 2j0t D: [137920] Other proteins in same PDB: d2j0ta_, d2j0tb_, d2j0tc_ automated match to d1d2ba_ complexed with ca, zn |
PDB Entry: 2j0t (more details), 2.54 Å
SCOPe Domain Sequences for d2j0td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0td_ b.40.3.1 (D:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]} ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty tvgc
Timeline for d2j0td_: