Lineage for d2j0tc1 (2j0t C:105-263)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867875Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 867917Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 867918Species Human (Homo sapiens) [TaxId:9606] [55530] (12 PDB entries)
    Uniprot P03956 32-466
  8. 867931Domain d2j0tc1: 2j0t C:105-263 [137919]
    Other proteins in same PDB: d2j0td1, d2j0te1, d2j0tf1
    automatically matched to d1ayk__
    complexed with ca, zn

Details for d2j0tc1

PDB Entry: 2j0t (more details), 2.54 Å

PDB Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1
PDB Compounds: (C:) interstitial collagenase

SCOP Domain Sequences for d2j0tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0tc1 d.92.1.11 (C:105-263) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
glshstdigalmypsytfsgdvqlaqddidgiqaiygrs

SCOP Domain Coordinates for d2j0tc1:

Click to download the PDB-style file with coordinates for d2j0tc1.
(The format of our PDB-style files is described here.)

Timeline for d2j0tc1: