SCOP 1.75: Domain d2j0ta1: 2j0t A:105-265

Lineage for d2j0ta1 (2j0t A:105-265)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55530] (12 PDB entries)
   Uniprot P03956 32-466

8. Domain d2j0ta1: 2j0t A:105-265 [137917]
   Other proteins in same PDB: d2j0td1, d2j0te1, d2j0tf1
   automatically matched to d1ayk__
   complexed with ca, zn

Details for d2j0ta1

PDB Entry: 2j0t, 2.54 Å

PDB Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1

PDB Compounds: (A:) interstitial collagenase

SCOP Domain Sequences for d2j0ta1:

Sequence; same for both SEQRES and ATOM records:

>d2j0ta1 d.92.1.11 (A:105-265) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
glshstdigalmypsytfsgdvqlaqddidgiqaiygrsqn

Timeline for d2j0ta1:

• d2j0ta1 first appeared in SCOP 1.73
  
• d2j0ta1 is called d2j0ta_ in SCOPe 2.01
  
• d2j0ta1 appears in the current release, SCOPe 2.08, called d2j0ta_