![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins) |
![]() | Protein Fibroblast collagenase (MMP-1) [55529] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55530] (12 PDB entries) |
![]() | Domain d2j0ta1: 2j0t A:105-265 [137917] Other proteins in same PDB: d2j0td1, d2j0te1, d2j0tf1 automatically matched to d1ayk__ complexed with ca, zn |
PDB Entry: 2j0t (more details), 2.54 Å
SCOP Domain Sequences for d2j0ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0ta1 d.92.1.11 (A:105-265) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl glshstdigalmypsytfsgdvqlaqddidgiqaiygrsqn
Timeline for d2j0ta1: