Lineage for d2j0sd1 (2j0s D:66-154)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724542Protein RNA-binding protein 8 [89938] (2 species)
  7. 724548Species Human (Homo sapiens) [TaxId:9606] [102978] (4 PDB entries)
    RBM8A, Y14
  8. 724549Domain d2j0sd1: 2j0s D:66-154 [137916]
    Other proteins in same PDB: d2j0sa1, d2j0sa2, d2j0sc1
    automatically matched to d1p27b_
    complexed with anp, mg

Details for d2j0sd1

PDB Entry: 2j0s (more details), 2.21 Å

PDB Description: the crystal structure of the exon junction complex at 2.2 a resolution
PDB Compounds: (D:) RNA-binding protein 8A

SCOP Domain Sequences for d2j0sd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0sd1 d.58.7.1 (D:66-154) RNA-binding protein 8 {Human (Homo sapiens) [TaxId: 9606]}
pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
eaqaameglngqdlmgqpisvdwcfvrgp

SCOP Domain Coordinates for d2j0sd1:

Click to download the PDB-style file with coordinates for d2j0sd1.
(The format of our PDB-style files is described here.)

Timeline for d2j0sd1: