SCOPe 2.08: Domain d2j0sd_: 2j0s D:

Lineage for d2j0sd_ (2j0s D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)

8. Domain d2j0sd_: 2j0s D: [137916]
   Other proteins in same PDB: d2j0sa1, d2j0sa2, d2j0sc_
   automated match to d1p27b_
   protein/DNA complex; protein/RNA complex; complexed with anp, mg

Details for d2j0sd_

PDB Entry: 2j0s, 2.21 Å

PDB Description: the crystal structure of the exon junction complex at 2.2 a resolution

PDB Compounds: (D:) RNA-binding protein 8A

SCOPe Domain Sequences for d2j0sd_:

Sequence; same for both SEQRES and ATOM records:

>d2j0sd_ d.58.7.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
eaqaameglngqdlmgqpisvdwcfvrgp

Timeline for d2j0sd_:

• d2j0sd_ first appeared in SCOP 1.73, called d2j0sd1
  
• d2j0sd_ appears in SCOPe 2.07