SCOPe 2.01: Domain d2j0sc_: 2j0s C:

Lineage for d2j0sc_ (2j0s C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.232: Mago nashi protein [89816] (1 superfamily)
   beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234

4. Superfamily d.232.1: Mago nashi protein [89817] (1 family)

5. Family d.232.1.1: Mago nashi protein [89818] (1 protein)

6. Protein Mago nashi protein [89819] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102750] (5 PDB entries)

8. Domain d2j0sc_: 2j0s C: [137915]
   Other proteins in same PDB: d2j0sa1, d2j0sa2, d2j0sd_
   automated match to d1p27a_
   protein/DNA complex; protein/RNA complex; complexed with anp, mg

Details for d2j0sc_

PDB Entry: 2j0s, 2.21 Å

PDB Description: the crystal structure of the exon junction complex at 2.2 a resolution

PDB Compounds: (C:) Protein mago nashi homolog

SCOPe Domain Sequences for d2j0sc_:

Sequence; same for both SEQRES and ATOM records:

>d2j0sc_ d.232.1.1 (C:) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]}
dfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkri
iddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvfy
ylvqdlkclvfsliglhfkikpi

Timeline for d2j0sc_:

• d2j0sc_ first appeared in SCOP 1.73, called d2j0sc1
  
• d2j0sc_ was called d2j0sc1 in SCOP 1.75
  
• d2j0sc_ appears in SCOPe 2.02
  
• d2j0sc_ appears in the current release, SCOPe 2.08