Lineage for d2j0sc1 (2j0s C:4-145)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740625Fold d.232: Mago nashi protein [89816] (1 superfamily)
    beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234
  4. 740626Superfamily d.232.1: Mago nashi protein [89817] (1 family) (S)
  5. 740627Family d.232.1.1: Mago nashi protein [89818] (1 protein)
  6. 740628Protein Mago nashi protein [89819] (2 species)
  7. 740634Species Human (Homo sapiens) [TaxId:9606] [102750] (4 PDB entries)
  8. 740635Domain d2j0sc1: 2j0s C:4-145 [137915]
    Other proteins in same PDB: d2j0sa1, d2j0sa2, d2j0sd1
    automatically matched to d1p27a_
    complexed with anp, mg

Details for d2j0sc1

PDB Entry: 2j0s (more details), 2.21 Å

PDB Description: the crystal structure of the exon junction complex at 2.2 a resolution
PDB Compounds: (C:) Protein mago nashi homolog

SCOP Domain Sequences for d2j0sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0sc1 d.232.1.1 (C:4-145) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]}
dfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkri
iddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvfy
ylvqdlkclvfsliglhfkikp

SCOP Domain Coordinates for d2j0sc1:

Click to download the PDB-style file with coordinates for d2j0sc1.
(The format of our PDB-style files is described here.)

Timeline for d2j0sc1: