SCOPe 2.08: Domain d2j0sa1: 2j0s A:21-243

Lineage for d2j0sa1 (2j0s A:21-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein automated matches [190301] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187108] (5 PDB entries)

8. Domain d2j0sa1: 2j0s A:21-243 [137913]
   Other proteins in same PDB: d2j0sc_, d2j0sd_
   automated match to d2j0sa1
   protein/DNA complex; protein/RNA complex; complexed with anp, mg

Details for d2j0sa1

PDB Entry: 2j0s, 2.21 Å

PDB Description: the crystal structure of the exon junction complex at 2.2 a resolution

PDB Compounds: (A:) ATP-dependent RNA helicase ddx48

SCOPe Domain Sequences for d2j0sa1:

Sequence; same for both SEQRES and ATOM records:

>d2j0sa1 c.37.1.19 (A:21-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdvia
qsqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchac
iggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeq
iydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkr

Timeline for d2j0sa1:

• d2j0sa1 first appeared in SCOP 1.73
  
• d2j0sa1 appears in SCOPe 2.07